PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa13g023200.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family MIKC_MADS
Protein Properties Length: 209aa    MW: 24040.9 Da    PI: 9.4546
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa13g023200.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF786.8e-25958150
                    S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
          SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                    krien  nr vtfskRr+g+ KKA+E+ vLCda+va+iif+s+gk+ +y+
  Csa13g023200.1  9 KRIENPNNRVVTFSKRRTGLVKKAKEITVLCDAKVALIIFASNGKMTDYC 58
                    79*********************************************997 PP

2K-box791.2e-2671169199
           K-box   1 yqkssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLr 95 
                     yqk sgk+l++ak+e+l++e++++kke+++Lq e+Rhl+Ged++sL+lk+L+ +e+++e++l k+R++++e+++++ ++ ++  +e+++ + +L+
  Csa13g023200.1  71 YQKLSGKKLWDAKHENLSNEIDRIKKENDSLQLELRHLKGEDIQSLNLKNLMAVEHAIEHGLDKVRDHQSEIVMTKRRTEKMIVEENRQLHFQLQ 165
                     899******************************************************************************************** PP

           K-box  96 kkle 99 
                     ++ +
  Csa13g023200.1 166 QQEM 169
                     9976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006630.011161IPR002100Transcription factor, MADS-box
SMARTSM004323.6E-37160IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.57E-33296IPR002100Transcription factor, MADS-box
CDDcd002651.11E-36280No hitNo description
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004042.1E-25323IPR002100Transcription factor, MADS-box
PfamPF003191.1E-211057IPR002100Transcription factor, MADS-box
PRINTSPR004042.1E-252338IPR002100Transcription factor, MADS-box
PRINTSPR004042.1E-253859IPR002100Transcription factor, MADS-box
PfamPF014861.2E-1682164IPR002487Transcription factor, K-box
PROSITE profilePS5129713.77484170IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 209 aa     Download sequence    Send to blast
MGRGKIEIKR IENPNNRVVT FSKRRTGLVK KAKEITVLCD AKVALIIFAS NGKMTDYCCP  60
SMDLGAMLDQ YQKLSGKKLW DAKHENLSNE IDRIKKENDS LQLELRHLKG EDIQSLNLKN  120
LMAVEHAIEH GLDKVRDHQS EIVMTKRRTE KMIVEENRQL HFQLQQQEMA IASNARGMMM  180
RDHDGQFGYR VQPIQPNLQE KIMSLVID*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3kov_A5e-16289180Myocyte-specific enhancer factor 2A
3kov_B5e-16289180Myocyte-specific enhancer factor 2A
3kov_I5e-16289180Myocyte-specific enhancer factor 2A
3kov_J5e-16289180Myocyte-specific enhancer factor 2A
3p57_A5e-16289180Myocyte-specific enhancer factor 2A
3p57_B5e-16289180Myocyte-specific enhancer factor 2A
3p57_C5e-16289180Myocyte-specific enhancer factor 2A
3p57_D5e-16289180Myocyte-specific enhancer factor 2A
3p57_I5e-16289180Myocyte-specific enhancer factor 2A
3p57_J5e-16289180Myocyte-specific enhancer factor 2A
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU5517630.0EU551763.1 Capsella bursa-pastoris PISTILLATA-like protein (PIb) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010454329.11e-154PREDICTED: floral homeotic protein PISTILLATA-like isoform X2
SwissprotP480071e-146PIST_ARATH; Floral homeotic protein PISTILLATA
TrEMBLA0A0D3B2281e-146A0A0D3B228_BRAOL; Uncharacterized protein
TrEMBLS5YL221e-146S5YL22_BRAOV; PI.b
STRINGAT5G20240.11e-144(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM53002751
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G20240.11e-147MIKC_MADS family protein